PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10019639
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family G2-like
Protein Properties Length: 305aa    MW: 34256.6 Da    PI: 7.1297
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10019639genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.48.9e-30190245156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+peLH+ Fv+++e+LGG++ AtPk+i++ m+v+gLt+++vkSHLQkYRl+
  Lus10019639 190 KQRRCWAPELHRLFVDVLEELGGPHAATPKQIRDKMQVEGLTNDEVKSHLQKYRLH 245
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.151187247IPR017930Myb domain
SuperFamilySSF466891.11E-14188248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-26188248IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-24190245IPR006447Myb domain, plants
PfamPF002492.0E-6192243IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MELSLDLGPV FVPKTVDQCL KEVSKLKDSN QKLSKLDDFV NRLEDERRKI DGFRRELPLC  60
FLLLTDVILK LKEEALVVKR NCCGEDDEEG KNKKQSWMES VQLWRNGDST CKSEQKQRSD  120
EEDNRSTCEN PIKKGSSGVR KEEEKEVVSQ ATELSLMTPF AAATQQVKVF HETVNNNKPR  180
LGLGQQFNKK QRRCWAPELH RLFVDVLEEL GGPHAATPKQ IRDKMQVEGL TNDEVKSHLQ  240
KYRLHIRKHS ASPTAQAKYG GNCNETSNDV NLLQSSSPQG PLVGSDGISE SHDSSNGAIE  300
KANV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310743.13e-90hypothetical protein POPTR_0007s11470g
TrEMBLB9HE753e-90B9HE75_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11470.18e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-65G2-like family protein